POMC antibody (AA 138-176)

Catalog No. ABIN2614195

This anti-POMC antibody is a Rabbit Polyclonal antibody detecting POMC in IHC and IHC (p). Suitable for Human and Monkey.

Quick Overview for POMC antibody (AA 138-176) (ABIN2614195)

Target: POMC (Proopiomelanocortin (POMC))

Reactivity: Human, Monkey

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POMC antibody is un-conjugated

Application: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-POMC Antibody

Binding Specificity: AA 138-176

Specificity: ACTH and MSH are produced by the pituitary gland.

Cross-Reactivity (Details): No cross reactivity with other proteins.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg sodium azide per 100 μg antibody.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for POMC

Target: POMC (Proopiomelanocortin (POMC))

Alternative Name: POMC / Proopiomelanocortin

Background: Name/Gene ID: POMC
Family: Hormone

Synonyms: POMC, Alpha-MSH, ACTH, Adrenocorticotropin, Adrenocorticotropic hormone, Beta-LPH, CLIP, Gamma-MSH, Lipotropin gamma, LPH, Melanotropin alpha, Met-enkephalin, Melanotropin beta, NPP, Pro-ACTH-endorphin, Lipotropin beta, Melanotropin gamma, MSH, Proopiomelanocortin, Beta-endorphin, Beta-MSH, Corticotropin-lipotropin, Gamma-LPH, POC, Pro-opiomelanocortin

Gene ID: 5443

Pathways: Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity, Feeding Behaviour