ATP2A2 antibody (AA 1-32)

Catalog No. ABIN2738411

This Rabbit Polyclonal antibody specifically detects ATP2A2 in WB, IHC and IHC (p). It exhibits reactivity toward Human, Mouse, Rat, Rabbit, Monkey, Cow, Dog, Guinea Pig, Horse, Pig, Chimpanzee, Gibbon and Sheep.

Quick Overview for ATP2A2 antibody (AA 1-32) (ABIN2738411)

Target: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Reactivity: Human, Mouse, Rat, Rabbit, Monkey, Cow, Dog, Guinea Pig, Horse, Pig, Chimpanzee, Gibbon, Sheep

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP2A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ATP2A2 Antibody

Binding Specificity: AA 1-32

Specificity: Isoform 1 is widely expressed in smooth muscle and nonmuscle tissues such as in adult skin epidermis, with highest expression in liver, pancreas and lung, and intermediate expression in brain, kidney and placenta. Also expressed at lower levels in heart and skeletal muscle. Isoforms 2 and 3 are highly expressed in the heart and slow twitch skeletal muscle. Expression of isoform 3 is predominantly restricted to cardiomyocytes and in close proximity to the sarcolemma. Both isoforms are mildly expressed in lung, kidney, liver, pancreas and placenta. Expression of isoform 3 is amplified during monocytic differentiation and also observed in the fetal heart. .

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for ATP2A2

Target: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Alternative Name: ATP2A2 / SERCA2

Background: Name/Gene ID: ATP2A2
Subfamily: ATPase - P type, type IIA
Family: Transporter

Synonyms: ATP2A2, ATP2B, Calcium pump 2, DAR, SR Ca(2+)-ATPase 2, Cardiac Ca2+ ATPase, DD, SERCA2

Gene ID: 488

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process