MMP3 antibody (AA 410-439)

Catalog No. ABIN2742989

The Rabbit Polyclonal anti-MMP3 antibody has been validated for WB. It is suitable to detect MMP3 in samples from Human and Gibbon.

Quick Overview for MMP3 antibody (AA 410-439) (ABIN2742989)

Target: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Reactivity: Human, Gibbon

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MMP3 Antibody

Binding Specificity: AA 410-439

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for MMP3

Target: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Alternative Name: MMP3

Background: Name/Gene ID: MMP3
Subfamily: Metallopeptidase M10A
Family: Protease

Synonyms: MMP3, CHDS6, MMP-3, Prostromelysin-1, Proteoglycanase, SL-1, STR1, Matrix metalloproteinase-3, Transin, Transin-1, SLN-1, STMY, Progelatinase, STMY1, Stromelysin-1

Gene ID: 4314