NPY antibody (AA 29-64)

Catalog No. ABIN2743210

This Rabbit Polyclonal antibody specifically detects NPY in WB, IHC and IHC (p). It exhibits reactivity toward Human, Rat, Mouse, Rabbit, Dog, Guinea Pig, Hamster, Monkey and Chimpanzee.

Quick Overview for NPY antibody (AA 29-64) (ABIN2743210)

Target: NPY (Neuropeptide Y (NPY))

Reactivity: Human, Rat, Mouse, Rabbit, Dog, Guinea Pig, Hamster, Monkey, Chimpanzee

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPY antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-NPY Antibody

Binding Specificity: AA 29-64

Specificity: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for NPY

Target: NPY (Neuropeptide Y (NPY))

Alternative Name: Neuropeptide Y / NPY

Background: Name/Gene ID: NPY
Family: Pancreatic hormone

Synonyms: NPY, Pro-neuropeptide Y, Neuropeptide Y, PYY4

Gene ID: 4852

Pathways: Feeding Behaviour