Peroxiredoxin 4 antibody (AA 178-2081)

Catalog No. ABIN2743788

This anti-Peroxiredoxin 4 antibody is a Rabbit Polyclonal antibody detecting Peroxiredoxin 4 in WB, IHC, ICC and IHC (p). Suitable for Human, Mouse, Rat, Horse, Monkey and Orang-Utan.

Quick Overview for Peroxiredoxin 4 antibody (AA 178-2081) (ABIN2743788)

Target: Peroxiredoxin 4 (PRDX4)

Reactivity: Human, Mouse, Rat, Horse, Monkey, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-Peroxiredoxin 4 Antibody

Binding Specificity: AA 178-2081

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for Peroxiredoxin 4

Target: Peroxiredoxin 4 (PRDX4)

Alternative Name: PRDX4 / Peroxiredoxin 4

Background: Name/Gene ID: PRDX4

Synonyms: PRDX4, Antioxidant enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin peroxidase AO372, Peroxiredoxin-4, PRX-4, Peroxiredoxin 4

Gene ID: 10549