Surfactant Protein A1 antibody (AA 206-237)

Catalog No. ABIN2744324

The Rabbit Polyclonal anti-Surfactant Protein A1 antibody has been validated for WB, IHC and IHC (p). It is suitable to detect Surfactant Protein A1 in samples from Human, Rat, Mouse, Chimpanzee and Orang-Utan.

Quick Overview for Surfactant Protein A1 antibody (AA 206-237) (ABIN2744324)

Target: Surfactant Protein A1 (SFTPA1)

Reactivity: Human, Rat, Mouse, Chimpanzee, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Surfactant Protein A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-Surfactant Protein A1 Antibody

Binding Specificity: AA 206-237

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for Surfactant Protein A1

Target: Surfactant Protein A1 (SFTPA1)

Alternative Name: SFTPA1 + SFTPA2

Background: Name/Gene ID: SFTPA1

Synonyms: SFTPA1, Alveolar proteinosis protein, COLEC4, Collectin-4, PSP-A, PSPA, SFTP1, SFTPA, SFTPA1B, SPA1, SP-A, SP-A1, SPA, Surfactant Protein A, Surfactant protein A1, Surfactant protein A1B

Gene ID: 653509