ZNF566 antibody (Middle Region)

Catalog No. ABIN2787529

This Rabbit Polyclonal antibody specifically detects ZNF566 in WB. It exhibits reactivity toward Human, Cow, Horse, Rat, Dog, Pig, Rabbit, Guinea Pig, Mouse and Zebrafish (Danio rerio).

Quick Overview for ZNF566 antibody (Middle Region) (ABIN2787529)

Target: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Reactivity: Human, Cow, Horse, Rat, Dog, Pig, Rabbit, Guinea Pig, Mouse, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF566 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZNF566 Antibody

Binding Specificity: Middle Region

Sequence: YECKECGKAF SSGSNFTQHQ RIHTGEKPYE CKECGNAFSQ SSQLIKHQRI

Predicted Reactivity: Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 93%, Rabbit: 93%, Rat: 100%, Zebrafish: 93%

Characteristics: This is a rabbit polyclonal antibody against Zfp566. It was validated on Western Blot.

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Application Details

Application Notes: Optimal working dilutions should be determined experimentally by the investigator.

Comment:

Antigen size: 386 AA

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freeze-thaw cycles.

Storage: -20 °C

Storage Comment: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Target Details for ZNF566

Target: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Alternative Name: Zfp566

Background: The function of this protein remains unknown.
Alias Symbols: RGD1563239
Protein Size: 386

Molecular Weight: 45 kDa

Gene ID: 502316

NCBI Accession: NM_001134726, NP_001128198

UniProt: B2RZ94