Unc5c antibody (C-Term)

Catalog No. ABIN3042323

Product Details anti-Unc5c Antibody

Target: Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))

Binding Specificity: AA 894-930, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Unc5c antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Netrin receptor UNC5C(UNC5C) detection. Tested with WB in Human,Mouse,Rat.

Sequence: DLWEAQNFPD GNLSMLAAVL EEMGRHETVV SLAAEGQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Netrin receptor UNC5C(UNC5C) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: unc-5 netrin receptor C
Protein Name: Netrin receptor UNC5C

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Unc5c

Target: Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))

Alternative Name: UNC5C (Unc5c Products)

Background: Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

Synonyms: homolog of C. elegans transmembrane receptor Unc5 antibody|Netrin receptor UNC5C antibody|Protein unc 5 homolog C antibody|Protein unc-5 homolog 3 antibody|Protein unc-5 homolog C antibody|Unc 5 homolog 3 antibody|Unc 5 homolog C antibody|Unc5 (C.elegans homolog) c antibody|Unc5c antibody|UNC5C_HUMAN antibody|UNC5H3 antibody

Gene ID: 8633

UniProt: O95185