GJA3 antibody (N-Term)
-
- Target See all GJA3 Antibodies
- GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))
-
Binding Specificity
- AA 89-118, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GJA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- TLIYLGHVLH IVRMEEKKKE REEEEQLKRE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: gap junction protein, alpha 3, 46 kDa
Protein Name: Gap junction alpha-3 protein - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product GJA3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))
- Alternative Name
- GJA3 (GJA3 Products)
- Background
-
Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).
Synonyms: CAE3 antibody|Connexin 46 antibody|Connexin-46 antibody|Connexin46 antibody|Cx46 antibody|CXA3_HUMAN antibody|CZP3 antibody|Gap junction alpha 3 protein antibody|Gap junction alpha-3 protein antibody|Gap junction protein, alpha 3, 46kD (connexin 46) antibody|Gap junction protein, alpha 3, 46 kDa (connexin 46) antibody|Gap junction protein, alpha 3, 46 kDa antibody|Gja3 antibody - Gene ID
- 2700
- UniProt
- Q9Y6H8
-