KNG1 antibody (Middle Region)

Catalog No. ABIN3043285

Product Details anti-KNG1 Antibody

Target: KNG1 (Kininogen 1 (KNG1))

Binding Specificity: AA 227-259, Middle Region

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KNG1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Kininogen-1(KNG1) detection. Tested with WB, IHC-P in Mouse.

Sequence: ECRGNLFMDI NNKIANFSQS CTLYSGDDLV EA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Kininogen-1(KNG1) detection. Tested with WB, IHC-P in Mouse.
Gene Name: kininogen 1
Protein Name: Kininogen-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for KNG1

Target: KNG1 (Kininogen 1 (KNG1))

Alternative Name: KNG1 (KNG1 Products)

Synonyms: BDK antibody, BK antibody, KNG antibody, Kng antibody, KNG2 antibody, fb64g01 antibody, wu:fb64g01 antibody, zgc:103569 antibody, kininogen antibody, bdk antibody, kng antibody, KNG1 antibody, IHRP antibody, KINKG antibody, KINKH antibody, Kng1 antibody, Kngk antibody, kininogen 1 antibody, kininogen 1 L homeolog antibody, inter-alpha-trypsin inhibitor heavy chain family member 4 antibody, kininogen 2-like 1 antibody, KNG1 antibody, Kng1 antibody, kng1 antibody, kng1.L antibody, ITIH4 antibody, Kng2l1 antibody

Background: Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins - high - molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.

Synonyms: Alpha-2-thiol proteinase inhibitor antibody|BDK antibody|BK antibody|Bradykinin antibody|Fitzgerald factor antibody|High molecular weight kininogen antibody|HMWK antibody|Ile-Ser-Bradykinin antibody|Kallidin I antibody|Kallidin II antibody|Kininogen antibody|KNG antibody|KNG1 antibody|KNG1_HUMAN antibody|Low molecular weight growth-promoting factor antibody|Williams-Fitzgerald-Flaujeac factor antibody

Gene ID: 16644

UniProt: O08677

Pathways: ACE Inhibitor Pathway, Glycosaminoglycan Metabolic Process