STXBP2 antibody (N-Term)
-
- Target See all STXBP2 Antibodies
- STXBP2 (Syntaxin Binding Protein 2 (STXBP2))
-
Binding Specificity
- AA 184-215, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STXBP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- QEYPAIRYRK GPEDTAQLAH AVLAKLNAFK AD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: syntaxin binding protein 2
Protein Name: Syntaxin-binding protein 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human STXBP2 (184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product STXBP2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- STXBP2 (Syntaxin Binding Protein 2 (STXBP2))
- Alternative Name
- STXBP2 (STXBP2 Products)
- Synonyms
- zgc:85807 antibody, FHL5 antibody, Hunc18b antibody, MUNC18-2 antibody, UNC18-2 antibody, UNC18B antibody, pp10122 antibody, C79054 antibody, Munc-18-2 antibody, Munc-18b antibody, Munc18b antibody, Sxtbp2 antibody, Sxtp2 antibody, Unc18-2 antibody, Unc18b antibody, muSec1 antibody, MUNC-18-2 antibody, syntaxin binding protein 2 antibody, stxbp2 antibody, STXBP2 antibody, Stxbp2 antibody
- Background
-
Syntaxin-binding protein 2, also known as UNC18B, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Synonyms: FHL5 antibody|Hunc18b antibody|MUNC18 2 antibody|pp10122 antibody|Protein unc-18 homolog 2 antibody|Protein unc-18 homolog B antibody| STXB2_HUMAN antibody|Stxbp2 antibody|syntaxin binding protein 2 antibody|Syntaxin-binding protein 2 antibody|Unc-18B antibody|UNC18 2 antibody|Unc18-2 antibody|UNC18B antibody - Gene ID
- 6813
- UniProt
- Q15833
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis
-