Sp2 antibody (Middle Region)
-
- Target See all Sp2 Antibodies
- Sp2 (Sp2 Transcription Factor (Sp2))
-
Binding Specificity
- AA 312-343, Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Sp2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Transcription factor Sp2(SP2) detection. Tested with WB in Human,Rat.
- Sequence
- QVVQIPQQAL RVVQAASATL PTVPQKPSQN FQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Transcription factor Sp2(SP2) detection. Tested with WB in Human,Rat.
Gene Name: Sp2 transcription factor
Protein Name: Transcription factor Sp2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human SP2 (312-343aa QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product Sp2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Sp2 (Sp2 Transcription Factor (Sp2))
- Alternative Name
- SP2 (Sp2 Products)
- Synonyms
- 4930480I16Rik antibody, mKIAA0048 antibody, sp2 antibody, Sp2 transcription factor antibody, Sp2 transcription factor S homeolog antibody, SP2 antibody, Sp2 antibody, sp2.S antibody
- Background
-
Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.
Synonyms: Kiaa0048 antibody|OTTHUMP00000196580 antibody|SP2 antibody|SP2_HUMAN antibody|SPECIFICITY PROTEIN 2 antibody|Transcription factor Sp2 antibody - Gene ID
- 6668
- UniProt
- Q02086
-