LIM Domain Kinase 1 antibody (C-Term)

Catalog No. ABIN3043411

Product Details anti-LIM Domain Kinase 1 Antibody

Target: LIM Domain Kinase 1 (LIMK1)

Binding Specificity: AA 599-634, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIM Domain Kinase 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for LIM domain kinase 1(LIMK1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: KLEHWLETLR MHLAGHLPLG PQLEQLDRGF WETYRR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for LIM domain kinase 1(LIMK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: LIM domain kinase 1
Protein Name: LIM domain kinase 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-LIM Domain Kinase 1 antibody (ABIN3043411)

Zhang, Gan, Zhou: "Immunohistochemical investigation of the correlation between LIM kinase 1 expression and development and progression of human ovarian carcinoma." in: The Journal of international medical research, Vol. 40, Issue 3, pp. 1067-73, (2013) (PubMed).

Target Details for LIM Domain Kinase 1

Target: LIM Domain Kinase 1 (LIMK1)

Alternative Name: LIMK1 (LIMK1 Products)

Synonyms: limk1 antibody, xlimk1 antibody, GB16654 antibody, LIMK1 antibody, LIMK antibody, LIMK-1 antibody, LIM domain kinase 1 antibody, LIM domain kinase 1a antibody, LIM domain kinase 1 L homeolog antibody, LIM-domain containing, protein kinase antibody, LIMK1 antibody, limk1a antibody, limk1 antibody, CpipJ_CPIJ000717 antibody, LOC413152 antibody, Limk1 antibody, limk1.L antibody

Background: LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

Synonyms: EC 2.7.11.1 antibody|LIM domain kinase 1 antibody|LIM motif-containing protein kinase antibody|LIMK antibody|LIMK-1 antibody|limk1 antibody|LIMK1_HUMAN antibody

Gene ID: 3984

UniProt: P53667

Pathways: Caspase Cascade in Apoptosis, Regulation of Cell Size, CXCR4-mediated Signaling Events