B3GNT8 antibody (C-Term)
-
- Target See all B3GNT8 Antibodies
- B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))
- Binding Specificity
- AA 360-397, C-Term
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8(B3GNT8) detection. Tested with WB, IHC-P in Human.
- Sequence
- ADRTADHCAF RNLLLVRPLG PQASIRLWKQ LQDPRLQC
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8(B3GNT8) detection. Tested with WB, IHC-P in Human.
Gene Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
Protein Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids.
- Isotype
- IgG
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))
- Alternative Name
- B3GNT8 (B3GNT8 Products)
- Synonyms
- B3GALT7 antibody, BGALT15 antibody, beta3Gn-T8 antibody, B3galt7 antibody, B7galt7 antibody, BC025206 antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 antibody, B3GNT8 antibody, B3gnt8 antibody
- Background
-
B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn(2+) and showed less efficiency with Co(2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans.
Synonyms: 3-Gn-T8 antibody|3-N-acetylglucosaminyltransferase 8 antibody|B3GN8_HUMAN antibody|B3gnt8 antibody|Beta-1 antibody|Beta3Gn-T8 antibody|BGnT-8 antibody|UDP-GlcNAc:betaGal beta-1 antibody - Gene ID
- 374907
- UniProt
- Q7Z7M8
-