HSP70 1A antibody (C-Term)

Catalog No. ABIN3043849

Product Details anti-HSP70 1A Antibody

Target: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Binding Specificity: AA 559-596, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSP70 1A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Heat shock 70 kDa protein 1A/1B(HSPA1A/HSPA1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KGKISEADKK KVLDKCQEVI SWLDANTLAE KDEFEHKR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Heat shock 70 kDa protein 1A/1B(HSPA1A/HSPA1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock protein family A (Hsp70) member 1A/1B
Protein Name: Heat shock 70 kDa protein 1A/1B

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-HSP70 1A antibody (ABIN3043849)

Zeng, Xiao, Deng, Li: "Chondroprotective Effects and Multitarget Mechanisms of Fu Yuan Capsule in a Rat Osteoarthritis Model." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2017, pp. 8985623, (2017) (PubMed).

Zhang, Tang, Li, Li, Zhang, Yan, Cui: "Effects of intracerebral hemorrhage and subsequent minimally invasive hematoma aspiration on expression of apoptosisrelated genes in rats." in: International journal of clinical and experimental pathology, Vol. 8, Issue 5, pp. 5371-8, (2016) (PubMed).

Chen, Wan, Huang, Wang, Liu, Wang: "Study on the immune response to recombinant Hsp70 protein from Megalobrama amblycephala." in: Immunobiology, Vol. 219, Issue 11, pp. 850-8, (2014) (PubMed).

Jing, Liu, Chen, Hu, Xiao, Ma: "Acute effect of copper and cadmium exposure on the expression of heat shock protein 70 in the Cyprinidae fish Tanichthys albonubes." in: Chemosphere, Vol. 91, Issue 8, pp. 1113-22, (2013) (PubMed).

Pu, Shi, Wang, Wang, Guo, Liu, Sun, Gao, Zhou: "Effects of minocycline on the expression of NGF and HSP70 and its neuroprotection role following intracerebral hemorrhage in rats." in: Journal of biomedical research, Vol. 25, Issue 4, pp. 292-8, (2013) (PubMed).

Chen, Zuo, Yang, Lu, Wang, Wang, Tu, Chen, Liu, Liu, Xiao: "Severe multiple organ injury in HSF1 knockout mice induced by lipopolysaccharide is associated with an increase in neutrophil infiltration and surface expression of adhesion molecules." in: Journal of leukocyte biology, Vol. 92, Issue 4, pp. 851-7, (2012) (PubMed).

Li, Roubeix, Wang, Shi, Liu, Baudouin, Chen: "Therapeutic efficacy of trehalose eye drops for treatment of murine dry eye induced by an intelligently controlled environmental system." in: Molecular vision, Vol. 18, pp. 317-29, (2012) (PubMed).

Fan, Jiang, Yang, Liu, Song, Pan: "Effects of adrenergic agents on stress-induced brain microstructural and immunochemical changes in adult male Wistar rats." in: Annals of anatomy = Anatomischer Anzeiger : official organ of the Anatomische Gesellschaft, Vol. 193, Issue 5, pp. 418-24, (2011) (PubMed).

Xu, Luo, Wu, Chen, Xu, Gao, He, Geng, Xiao, Zhang, Chen, Li: "Immunohistological evaluation of skin responses after treatment using a fractional ultrapulse carbon dioxide laser on back skin." in: Dermatologic surgery : official publication for American Society for Dermatologic Surgery [et al.], Vol. 37, Issue 8, pp. 1141-9, (2011) (PubMed).

Ouyang, Gao, Wang, Xie, Lei, Zhou, Liao, Zhong, Tang: "Thermoseed hyperthermia treatment of mammary orthotopic transplantation tumors in rats and impact on immune function." in: Oncology reports, Vol. 24, Issue 4, pp. 973-9, (2010) (PubMed).

Yi, Peng, Chang, Peng, Yan, Lin: "Effect of pre-moxibustion on apoptosis and proliferation of gastric mucosa cells." in: World journal of gastroenterology, Vol. 13, Issue 15, pp. 2174-8, (2007) (PubMed).

Wu, Cao, Gao, Chen, Wang, Zumbika, Qian: "Down-modulation of heat shock protein 70 and up-modulation of Caspase-3 during schisandrin B-induced apoptosis in human hepatoma SMMC-7721 cells." in: World journal of gastroenterology, Vol. 10, Issue 20, pp. 2944-8, (2004) (PubMed).

Gnatyshak, Loginskiĭ, Mazurok: "[Homo- and autotransplantation of bone marrow in radiation and chemotherapy of oncologic patients]." in: Vrachebnoe delo, Vol. 4, pp. 129-32, (1973) (PubMed).

Target Details for HSP70 1A

Target: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Alternative Name: HSPA1A (HSPA1A Products)

Synonyms: hsp70-4 antibody, hspa1a antibody, Hsp70-3 antibody, Hsp70.3 antibody, Hsp72 antibody, hsp68 antibody, hsp70A1 antibody, HSP72 antibody, Hsp70-1 antibody, Hspa1 antibody, Hspa1b antibody, hsp70-1 antibody, hsp70-1a antibody, hsp70i antibody, hsp72 antibody, hspa1 antibody, hspa1b antibody, HSP70-1 antibody, HSP70-1A antibody, HSP70I antibody, HSPA1 antibody, HSPA1A antibody, HSPA1B antibody, HSP70-2 antibody, HSPA2 antibody, HSP70 antibody, hspA1A antibody, heat shock cognate 70-kd protein, tandem duplicate 3 antibody, heat shock 70 kDa protein 1 antibody, heat shock 70 kDa protein II antibody, heat shock protein 1A antibody, heat shock 70kD protein 1A antibody, heat shock protein family A (Hsp70) member 1A S homeolog antibody, heat shock protein family A (Hsp70) member 1A antibody, heat shock protein 70.2 antibody, heat shock 70kDa protein 1A antibody, heat shock 70 kDa protein 1B antibody, heat shock protein 70.1 antibody, hsp70.3 antibody, LOC100023597 antibody, LOC100554002 antibody, LOC100608888 antibody, Hspa1a antibody, hspa1a.S antibody, HSPA1A antibody, HSP70.2 antibody, LOC100354037 antibody, HSP70.1 antibody

Background: HSPA1 (heat shock 70 kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70 kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.

Synonyms: DAQB 147D11.1 001 antibody|FLJ54303 antibody|FLJ54370 antibody|FLJ54392 antibody|FLJ54408 antibody|FLJ75127 antibody|Heat shock 70 kDa protein 1 antibody|Heat shock 70 kDa protein 1/2 antibody|Heat shock 70 kDa protein 1A/1B antibody|heat shock 70 kDa protein 1A antibody|Heat shock 70 kDa protein 1B antibody|Heat shock induced protein antibody|heat shock protein 70 antibody|HSP70 1 antibody| HSP70 2 antibody|HSP70-1/HSP70-2 antibody|HSP70-1A antibody| HSP70.1 antibody|HSP70.1/HSP70.2 antibody|HSP70I antibody|HSP71_HUMAN antibody|HSP72 antibody|HSPA1 antibody|HSPA1A antibody|HSPA1B antibody|XXbac BCX40G17.3 001 antibody

Gene ID: 3303, 3304

UniProt: P08P09

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process