IGFBP3 antibody (C-Term)
-
- Target See all IGFBP3 Antibodies
- IGFBP3 (Insulin-Like Growth Factor Binding Protein 3 (IGFBP3))
-
Binding Specificity
- AA 214-252, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGFBP3 antibody is un-conjugated
-
Application
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
- Sequence
- RREMEDTLNH LKFLNVLSPR GVHIPNCDKK GFYKKKQCR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
Gene Name: insulin-like growth factor binding protein 3
Protein Name: Insulin-like growth factor-binding protein 3 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product IGFBP3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
shRNA constructs targeting IGFBP-3 alleviate age related erectile dysfunction in the rat." in: The Journal of urology, Vol. 192, Issue 3, pp. 990-6, (2014) (PubMed).
: "Higher expression of mRNA and protein of insulin-like growth factor binding protein-3 in old rat penile tissues: implications for erectile dysfunction." in: The journal of sexual medicine, Vol. 8, Issue 8, pp. 2181-90, (2011) (PubMed).
: "
-
shRNA constructs targeting IGFBP-3 alleviate age related erectile dysfunction in the rat." in: The Journal of urology, Vol. 192, Issue 3, pp. 990-6, (2014) (PubMed).
-
- Target
- IGFBP3 (Insulin-Like Growth Factor Binding Protein 3 (IGFBP3))
- Alternative Name
- IGFBP3 (IGFBP3 Products)
- Background
-
IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms: Acid stable subunit of the 140 K IGF complex antibody|Binding protein 29 antibody|Binding protein 53 antibody|BP 53 antibody|BP53 antibody|Growth hormone dependent binding protein antibody|IBP 3 antibody|IBP-3 antibody|IBP3 antibody|IBP3_HUMAN antibody|IGF binding protein 3 antibody|IGF-binding protein 3 antibody|IGFBP 3 antibody|IGFBP-3 antibody|IGFBP3 antibody|Insulin Like Growth Factor Binding Protein 3 antibody|Insulin-like growth factor-binding protein 3 antibody - Gene ID
- 3486
- UniProt
- P17936
- Pathways
- Myometrial Relaxation and Contraction, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process, Autophagy, Smooth Muscle Cell Migration, Growth Factor Binding
-