SLC22A2 antibody (Middle Region)

Catalog No. ABIN3043926

Product Details anti-SLC22A2 Antibody

Target: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Binding Specificity: AA 524-555, Middle Region

Reactivity: Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: ETIEEAENMQ RPRKNKEKMI YLQVQKLDIP LN

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: solute carrier family 22 (organic cation transporter), member 2
Protein Name: Solute carrier family 22 member 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human , The detection limit for SLC22A2 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for SLC22A2

Target: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Alternative Name: SLC22A2 (SLC22A2 Products)

Background: SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Synonyms: MGC32628 antibody|OCT 2 antibody|OCT2 antibody|Organic cation transporter 2 antibody|Organic cation transporter antibody|RP11-317M22.2 antibody|Solute carrier family 22 (organic cation transporter) member 2 antibody|Solute carrier family 22 member 2 antibody

Gene ID: 6582

UniProt: O15244