Integrin alpha 3B, alpha 6B antibody

Catalog No. ABIN335348

There is 1 publication for this product available. The Mouse Monoclonal anti-Integrin alpha 3B, alpha 6B antibody is suitable to detect Integrin alpha 3B, alpha 6B in samples from Human. It has been validated for ICC, IHC (fro), IHC and WB.

Quick Overview for Integrin alpha 3B, alpha 6B antibody (ABIN335348)

Target: Integrin alpha 3B, alpha 6B

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Application: Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (IHC), Western Blotting (WB)

Clone: PB36

Product Details

Specificity: Human. A broad species reactivity is expected because of the conserved nature of the epitope.

Purification: Purified

Immunogen: PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.

Isotype: IgG1

Application Details

Application Notes: PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. PB36 reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart. PB36 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration, recommended range is 1:50 - 1:100 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:500 for immunoblotting applications.

Restrictions: For Research Use only

Handling

Storage: 4 °C

References

de Melker, Sterk, Delwel, Fles, Daams, Weening, Sonnenberg: "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." in: Laboratory investigation; a journal of technical methods and pathology, Vol. 76, Issue 4, pp. 547-63, (1997) (PubMed).

Target Details

Target: Integrin alpha 3B, alpha 6B

Alternative Name: Integrin alpha 3B+alpha 6B

Background: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.