ERK1 antibody (AA 336-367)

Catalog No. ABIN351563

The Rabbit Polyclonal anti-ERK1 antibody is suitable to detect ERK1 in samples from Mouse, Rat, Rabbit and Hamster. It has been validated for WB, IHC and IP.

Quick Overview for ERK1 antibody (AA 336-367) (ABIN351563)

Target: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Reactivity: Mouse, Rat, Rabbit, Hamster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERK1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Product Details anti-ERK1 Antibody

Binding Specificity: AA 336-367

Specificity: This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.

Predicted Reactivity: Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).

Purification: Protein A purified

Immunogen: A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated

Application Details

Application Notes: Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB

Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract.

Comment:

Target Species of Antibody: Rat

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Liquid

Handling Advice: Avoid repeat freeze-thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Target Details for ERK1

Target: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Alternative Name: MAPK3 / ERK1

Background: Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3

Gene ID: 5595

UniProt: P27361

Pathways: MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins