ERK1 antibody (AA 336-367)
-
- Target See all ERK1 (MAPK3) Antibodies
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
-
Binding Specificity
- AA 336-367
-
Reactivity
- Mouse, Rat, Rabbit, Hamster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERK1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
- Specificity
- This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
- Predicted Reactivity
- Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
- Purification
- Protein A purified
- Immunogen
-
A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).
Type of Immunogen: Synthetic peptide - KLH conjugated - Top Product
- Discover our top product MAPK3 Primary Antibody
-
-
- Application Notes
-
Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB
Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract. - Comment
-
Target Species of Antibody: Rat
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Liquid
- Handling Advice
- Avoid repeat freeze-thaw cycles.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Target
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
- Alternative Name
- MAPK3 / ERK1 (MAPK3 Products)
- Background
-
Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase
Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3 - Gene ID
- 5595
- UniProt
- P27361
- Pathways
- MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
-