ACADVL antibody (C-Term)
-
- Target See all ACADVL Antibodies
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
-
Binding Specificity
- AA 538-576, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACADVL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human,Rat.
- Sequence
- RALEQFATVV EAKLIKHKKG IVNEQFLLQR LADGAIDLY
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human,Rat.
Gene Name: acyl-CoA dehydrogenase, very long chain
Protein Name: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538-576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ACADVL Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
- Alternative Name
- ACADVL (ACADVL Products)
- Synonyms
- ACAD6 antibody, LCACD antibody, VLCAD antibody, vlcad antibody, fb52d04 antibody, wu:fb52d04 antibody, wu:fc75e01 antibody, zgc:64067 antibody, acyl-CoA dehydrogenase very long chain antibody, acyl-Coenzyme A dehydrogenase, very long chain antibody, acyl-CoA dehydrogenase, very long chain antibody, ACADVL antibody, Acadvl antibody, acadvl antibody
- Background
-
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Synonyms: ACAD 6 | ACAD6 | Acadvl | LCACD | VLCAD | P49748 - Gene ID
- 37
- UniProt
- P49748
- Pathways
- ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process
-