BCL2L1 antibody (Middle Region)
-
- Target See all BCL2L1 Antibodies
- BCL2L1 (BCL2-Like 1 (BCL2L1))
-
Binding Specificity
- AA 75-105, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BCL2L1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Bcl-2-like protein 1(BCL2L1) detection. Tested with WB in Human.
- Sequence
- LDAREVIPMA AVKQALREAG DEFELRYRRA F
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Bcl-2-like protein 1(BCL2L1) detection. Tested with WB in Human.
Gene Name: BCL2-like 1
Protein Name: Bcl-2-like protein 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product BCL2L1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Emodin alleviates severe acute pancreatitis-associated acute lung injury by decreasing pre-B-cell colony-enhancing factor expression and promoting polymorphonuclear neutrophil apoptosis." in: Molecular medicine reports, Vol. 16, Issue 4, pp. 5121-5128, (2018) (PubMed).
: "Azithromycin synergistically enhances anti-proliferative activity of vincristine in cervical and gastric cancer cells." in: Cancers, Vol. 4, Issue 4, pp. 1318-32, (2013) (PubMed).
: "
-
Emodin alleviates severe acute pancreatitis-associated acute lung injury by decreasing pre-B-cell colony-enhancing factor expression and promoting polymorphonuclear neutrophil apoptosis." in: Molecular medicine reports, Vol. 16, Issue 4, pp. 5121-5128, (2018) (PubMed).
-
- Target
- BCL2L1 (BCL2-Like 1 (BCL2L1))
- Alternative Name
- BCL2L1 (BCL2L1 Products)
- Synonyms
- BCL-XL/S antibody, BCL2L antibody, BCLX antibody, BCLXL antibody, BCLXS antibody, Bcl-X antibody, PPP1R52 antibody, bcl-xL antibody, bcl-xS antibody, Bcl(X)L antibody, Bcl-XL antibody, Bcl-Xs antibody, Bcl2l antibody, BclX antibody, bcl-x antibody, Bcl-xl antibody, Bclx antibody, bcl-X antibody, Bcl-xL antibody, BCL-XL antibody, BCL2L1 antibody, bcl-XL antibody, bcl-x(l) antibody, bcl-xl/s antibody, bcl-xs antibody, bcl2l antibody, bclx antibody, bclxl antibody, xR11 antibody, bcl-xl antibody, blp1 antibody, cb1021 antibody, zfBLP1 antibody, BCL2 like 1 antibody, BCL2-like 1 antibody, Bcl2-like 1 antibody, BCL2-like 1 L homeolog antibody, bcl2-like 1 antibody, BCL2L1 antibody, Bcl2l1 antibody, bcl2l1 antibody, bcl2l1.L antibody
- Background
-
Bcl-2-like protein 1, also known as Bcl-X, is a protein that in humans is encoded by the BCL2L1 gene. The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform (Bcl-xL) acts as an apoptotic inhibitor and the shorter form (Bcl-xS) acts as an apoptotic activator.
Synonyms: Apoptosis regulator BclX | Bcl 2 like 1 | Bcl2 like1 | Bcl 2 like 1 protein | Bcl xL | BCL XL/S | Bcl xS | BCL2L | BCL2L1 | Bclx | Q07817 - Gene ID
- 598
- UniProt
- Q07817
- Pathways
- Apoptosis, Negative Regulation of intrinsic apoptotic Signaling
-