BDKRB2 antibody (C-Term)

Catalog No. ABIN4886484

Product Details anti-BDKRB2 Antibody

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Binding Specificity: AA 357-391, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BDKRB2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection. Tested with WB in Human.

Sequence: RSEPIQMENS MGTLRTSISV ERQIHKLQDW AGSRQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection. Tested with WB in Human.
Gene Name: bradykinin receptor B2
Protein Name: B2 bradykinin receptor

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for BDKRB2

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Alternative Name: BDKRB2 (BDKRB2 Products)

Synonyms: BDKRB2 antibody, b2r antibody, bk2 antibody, bk-2 antibody, bkr2 antibody, brb2 antibody, kinrec antibody, B2R antibody, BK-2 antibody, BK2 antibody, BKR2 antibody, BRB2 antibody, B2BKR antibody, B2BRA antibody, B(2) antibody, B2 antibody, BK2R antibody, Bdkrb2 antibody, bradykinin receptor B2 antibody, bradykinin receptor, beta 2 antibody, bradykinin type 2 receptor antibody, Bdkrb2 antibody, BDKRB2 antibody, bdkrb2 antibody, kinrec antibody, B2R antibody

Background: Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Synonyms: B2 | B2BKR | B2BRA | B2R | BDKR B2 | BDKRB 2 | BDKRB2 | BK 2 | BK 2 receptor | BK R2 | BK-2 receptor | BK2 | BK2 receptor | BK2R | BKR 2 | BKR2 | BR B2 | BRB 2 | BRB2 | Kinin B2 | P30411

Gene ID: 624

UniProt: P30411

Pathways: ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling