CCDC6 antibody (N-Term)

Catalog No. ABIN4886506

Product Details anti-CCDC6 Antibody

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Binding Specificity: AA 156-198, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC6 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human,Rat.

Sequence: KAELEQHLEQ EQEFQVNKLM KKIKKLENDT ISKQLTLEQL RR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human,Rat.
Gene Name: coiled-coil domain containing 6
Protein Name: Coiled-coil domain-containing protein 6

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for CCDC6

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Alternative Name: CCDC6 (CCDC6 Products)

Background: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

Synonyms: CCDC 6 | CCDC6 | D10S170 | H4 | Protein H4 | PTC | TPC | TST1 | TST 1 | Q16204

Gene ID: 8030

UniProt: Q16204