HDGF antibody (C-Term)

Catalog No. ABIN4886613

Product Details anti-HDGF Antibody

Target: HDGF (Hepatoma-Derived Growth Factor (HDGF))

Binding Specificity: AA 61-97, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HDGF antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: hepatoma-derived growth factor
Protein Name: Hepatoma-derived growth factor

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HDGF

Target: HDGF (Hepatoma-Derived Growth Factor (HDGF))

Alternative Name: HDGF (HDGF Products)

Synonyms: HMG1L2 antibody, hmg1l2 antibody, HDGF antibody, DKFZp459H185 antibody, AI118077 antibody, D3Ertd299e antibody, heparin binding growth factor antibody, hepatoma-derived growth factor antibody, hepatoma-derived growth factor (high-mobility group protein 1-like) antibody, heparin binding growth factor L homeolog antibody, hepatoma-derived growth factor-like antibody, HDGF antibody, hdgf antibody, Hdgf antibody, hdgf.L antibody, LOC100357981 antibody

Background: Hepatoma-derived growth factor (HDGF), also known as high mobility group protein 1-like 2 (HMG-1L2), is a protein that in humans is encoded by the HDGF gene. This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. And this gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Synonyms: HDGF | HMG-1L2 | HMG1L2 | P51858

Gene ID: 3068

UniProt: P51858

Pathways: ER-Nucleus Signaling