KRIT1 antibody (C-Term)

Catalog No. ABIN4886652

Product Details anti-KRIT1 Antibody

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Binding Specificity: AA 703-736, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRIT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Krev interaction trapped protein 1(KRIT1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: ENKMSFIVHT KQAGLVVKLL MKLNGQLMPT ERNS

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Krev interaction trapped protein 1(KRIT1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: KRIT1, ankyrin repeat containing
Protein Name: Krev interaction trapped protein 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human KRIT1 (703-736aa ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS), different from the related mouse sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for KRIT1

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Alternative Name: KRIT1 (KRIT1 Products)

Background: Krev interaction trapped protein 1(KRIT1) is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

Synonyms: CAM | CCM 1 | CCM1 | KRIT 1 | KRIT1 | O00522

Gene ID: 889

UniProt: O00522

Pathways: Cell RedoxHomeostasis