PVRL4 antibody (N-Term)
-
- Target See all PVRL4 Antibodies
- PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))
-
Binding Specificity
- AA 53-94, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PVRL4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Tested with WB in Human.
- Sequence
- FYRGDSGEQV GQVAWARVDA GEGAQELALL HSKYGL
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Tested with WB in Human.
Gene Name: nectin cell adhesion molecule 4
Protein Name: Nectin-4 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PVRL4 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))
- Alternative Name
- NECTIN4 (PVRL4 Products)
- Synonyms
- PVRL4 antibody, si:ch211-155e24.1 antibody, 1200017F15Rik antibody, Prr4 antibody, RGD1559826 antibody, EDSS1 antibody, LNIR antibody, PRR4 antibody, nectin-4 antibody, nectin cell adhesion molecule 4 antibody, NECTIN4 antibody, nectin4 antibody, Nectin4 antibody
- Background
-
PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.
Synonyms: EDSS1 | Nectin 4 | Nectin-4 | PRR4 | pvrl4 | Q96NY8 - Gene ID
- 81607
- Pathways
- Cell-Cell Junction Organization
-