ST7 antibody (Middle Region)

Catalog No. ABIN4886732

Product Details anti-ST7 Antibody

Target: ST7 (Suppression of Tumorigenicity 7 (ST7))

Binding Specificity: AA 268-309, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST7 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.

Sequence: DGCYRRSQQL QHHGSQYEAQ HRRDTNVLVY IKRRLAMCAR RL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.
Gene Name: suppression of tumorigenicity 7
Protein Name: Suppressor of tumorigenicity 7 protein

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ST7

Target: ST7 (Suppression of Tumorigenicity 7 (ST7))

Alternative Name: ST7 (ST7 Products)

Synonyms: ETS7q antibody, FAM4A antibody, FAM4A1 antibody, HELG antibody, RAY1 antibody, SEN4 antibody, TSG7 antibody, 9430001H04Rik antibody, Fam4a2 antibody, suppression of tumorigenicity 7 antibody, ST7 antibody, St7 antibody

Background: Suppressor of tumorigenicity protein 7 is a protein that in humans is encoded by the ST7 gene. The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.

Synonyms: ETS7q | FAM4A | FAM4A1 | HELG | RAY1 | SEN4 | ST7 | TSG7 | Q9NRC1

Gene ID: 7982