ZP1 antibody (N-Term)

Catalog No. ABIN4886775

Product Details anti-ZP1 Antibody

Target: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Binding Specificity: AA 102-139, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 1(ZP1) detection. Tested with WB in Human,Rat.

Sequence: HVLEKDGRFH LRVFMEAVLP NGRVDVAQDA TLICPKPD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 1(ZP1) detection. Tested with WB in Human,Rat.
Gene Name: zona pellucida glycoprotein 1
Protein Name: Zona pellucida sperm-binding protein 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZP1 (102-139aa HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ZP1

Target: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Alternative Name: ZP1 (ZP1 Products)

Background: Zona pellucida sperm-binding protein 1 (ZP1) is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.

Synonyms: Zp1 | Zp-1 | Zp 1 | P60852

Gene ID: 22917

UniProt: P60852