ATG14 antibody

Catalog No. ABIN4950253

The Rabbit Polyclonal anti-ATG14 antibody is suitable to detect ATG14 in samples from Human and Rat. It has been validated for WB, FACS, IF and IHC (p).

Quick Overview for ATG14 antibody (ABIN4950253)

Target: ATG14 (ATG14 Autophagy Related 14 (ATG14))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATG14 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ATG14 Antibody

Purpose: ATG14L Antibody

Sequence: RDRERFIDKK ERLSRLKSKQ EEFQKEVLKA ME

Purification: Antigen affinity

Immunogen: Amino acids RDRERFIDKKERLSRLKSKQEEFQKEVLKAME of human ATG14L were used as the immunogen for the ATG14L antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ATG14L antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ATG14L antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ATG14

Target: ATG14 (ATG14 Autophagy Related 14 (ATG14))

Alternative Name: ATG14L

Background: ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.

UniProt: Q6ZNE5

Pathways: Autophagy