ATG14 antibody

Catalog No. ABIN4950253

The Rabbit Polyclonal anti-ATG14 antibody is suitable to detect ATG14 in samples from Human and Rat. It has been validated for WB, FACS and IHC (p).

Quick Overview for ATG14 antibody (ABIN4950253)

Target: ATG14 (ATG14 Autophagy Related 14 (ATG14))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATG14 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ATG14 Antibody

Purification: Antigen affinity

Immunogen: Amino acids RDRERFIDKKERLSRLKSKQEEFQKEVLKAME of human ATG14L were used as the immunogen for the ATG14L antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ATG14L antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ATG14L antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ATG14

Target: ATG14 (ATG14 Autophagy Related 14 (ATG14))

Alternative Name: ATG14L

Background: ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.

UniProt: Q6ZNE5

Pathways: Autophagy