BCAR3 antibody

Catalog No. ABIN4950307

Product Details anti-BCAR3 Antibody

Target: BCAR3 (Breast Cancer Anti-Estrogen Resistance 3 (BCAR3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCAR3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL of human BCAR3 were used as the immunogen for the BCAR3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the BCAR3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the BCAR3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for BCAR3

Target: BCAR3 (Breast Cancer Anti-Estrogen Resistance 3 (BCAR3))

Alternative Name: BCAR3 (BCAR3 Products)

Synonyms: NSP2 antibody, SH2D3B antibody, AI131758 antibody, AND-34 antibody, BCAR3 antibody, breast cancer anti-estrogen resistance 3 antibody, breast cancer anti-estrogen resistance 3 L homeolog antibody, BCAR3 antibody, Bcar3 antibody, bcar3 antibody, bcar3.L antibody

Background: Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene. Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. BCAR3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: O75815