CSNK1A1 antibody

Catalog No. ABIN4950677

Product Details anti-CSNK1A1 Antibody

Target: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSNK1A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ of human CSNK1A1 were used as the immunogen for the CSNK1A1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CSNK1A1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CSNK1A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CSNK1A1

Target: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Alternative Name: CSNK1A1 (CSNK1A1 Products)

Synonyms: CK1 antibody, CK1a antibody, CKIa antibody, HLCDGP1 antibody, PRO2975 antibody, 2610208K14Rik antibody, 4632404G05Rik antibody, 5430427P18Rik antibody, Csnk1a antibody, CHUNP6894 antibody, ck1alpha antibody, wu:fb65a02 antibody, wu:fi30h04 antibody, wu:fj19c11 antibody, zgc:92158 antibody, KER1 antibody, ck1 antibody, CKIALPHA antibody, CK-II antibody, CSNK2A1 antibody, CG2028 antibody, CK I antibody, CK1alpha antibody, CKI antibody, CKI alpha antibody, CKIalpha antibody, CkIa antibody, Dmel\\CG2028 antibody, PKA-C antibody, anon-WO03040301.93 antibody, anon-WO03040301.95 antibody, ck1a antibody, dmCK1 antibody, dmckI antibody, l(1)G0492 antibody, casein kinase 1 alpha 1 antibody, casein kinase 1, alpha 1 antibody, keratin 1 antibody, casein kinase 1 alpha 1 L homeolog antibody, casein kinase 2 alpha 1 antibody, Casein kinase Ialpha antibody, CSNK1A1 antibody, Csnk1a1 antibody, csnk1a1 antibody, KRT1 antibody, csnk1a1.L antibody, CSNK2A1 antibody, CkIalpha antibody

Background: Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

UniProt: P48729

Pathways: WNT Signaling, Hedgehog Signaling