RBBP4 / RbAp48 / NURF55 antibody

Catalog No. ABIN4952377

The Rabbit Polyclonal anti- antibody has been validated for IHC (p), WB and IHC (fro). It is suitable to detect in samples from Human, Mouse and Rat.

Quick Overview for RBBP4 / RbAp48 / NURF55 antibody (ABIN4952377)

Target: RBBP4 / RbAp48 / NURF55

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Product Details

Purification: Antigen affinity

Immunogen: Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS of human Retinoblastoma binding protein 4 were used as the immunogen for the RBBP4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the RBBP4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the RBBP4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details

Target: RBBP4 / RbAp48 / NURF55

Background: Retinoblastoma binding protein 4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q09028