RBBP4 / RbAp48 / NURF55 antibody
-
- Target
- RBBP4 / RbAp48 / NURF55
- Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
- Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Purification
- Antigen affinity
- Immunogen
- Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS of human Retinoblastoma binding protein 4 were used as the immunogen for the RBBP4 antibody.
- Isotype
- IgG
-
-
- Application Notes
- Optimal dilution of the RBBP4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the RBBP4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- RBBP4 / RbAp48 / NURF55
- Background
- Retinoblastoma binding protein 4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.
- UniProt
- Q09028
-