IL32 antibody (Interleukin 32) (AA 1-188)

Details for Product anti-IL32 Antibody No. ABIN522699
Antigen
Epitope
AA 1-188
23
16
9
8
7
6
5
5
3
3
2
2
2
2
2
1
1
1
1
Reactivity
Human
135
23
4
Host
Rabbit
115
19
1
Clonality
Polyclonal
Conjugate
This IL32 antibody is un-conjugated
7
6
5
4
4
3
1
1
1
1
1
1
1
Application
Western Blotting (WB)
103
62
44
19
12
7
6
5
4
3
2
2
1
1
1
1
Options
Purpose Rabbit polyclonal antibody raised against a full-length human IL32 protein.
Brand MaxPab®
Immunogen

immunogen: IL32 (NP_001012649.1, 1 a.a. ~ 188 a.a) full-length human protein.

Immunogen Sequence: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK

Cross-Reactivity Human, Mouse (Murine)
Antigen
Alternative Name IL32 (IL32 Antibody Abstract)
Background Full Gene Name: interleukin 32
Synonyms: IL-32alpha,IL-32beta,IL-32delta,IL-32gamma,NK4,TAIF,TAIFa,TAIFb,TAIFc,TAIFd
Gene ID 9235
NCBI Accession NP_001012649, NM_001012631
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Interleukin 32 (IL32) (AA 1-188) antibody (ABIN522699) Western Blot analysis of IL32 expression in transfected 293T cell line by IL32 MaxPab...
Image no. 2 for anti-Interleukin 32 (IL32) (AA 1-188) antibody (ABIN522699) IL32 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL32 expression in h...
Image no. 3 for anti-Interleukin 32 (IL32) (AA 1-188) antibody (ABIN522699) IL32 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL32 expression in m...