ZNF611 antibody (Zinc Finger Protein 611) (AA 1-151) Primary Antibody
ZNF611
Reactivity: Human
IF, ELISA
Host: Mouse
Monoclonal
4F1
camera_alt 2
Catalog No. ABIN529412
$440.00
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-151
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
- This ZNF611 antibody is un-conjugated
- Application
- Immunofluorescence (IF), ELISA
- Purpose
- Mouse monoclonal antibody raised against a full length recombinant ZNF611.
- Cross-Reactivity
- Human
- Immunogen
immunogen: ZNF611 (AAH00918, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: MLQRLQIIGESIMKRDLTSVINVANFSEIVHILQVIGELILERNLTNVMTVPRSSVKLHPMQNIGEFIQERNLTSVMIVAKPLLHVHTSLDIRESILDRNLTNVISVARSSVQDHSMQNIRKFIFEITVPNEMSIANHQALIDIGVNSALT
- Clone
- 4F1
- Isotype
- IgG2b kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- ZNF611 (ZNF611 Antibody Abstract)
- Synonyms
- zinc finger protein 611, ZNF611
- Background
- Full Gene Name: zinc finger protein 611
Synonyms: MGC5384 - Gene ID
- 81856
You are here: