POLQ antibody (C-Term)

Catalog No. ABIN5515979

This anti-POLQ antibody is a Rabbit Polyclonal antibody detecting POLQ in WB. Suitable for Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse and Rabbit.

Quick Overview for POLQ antibody (C-Term) (ABIN5515979)

Target: POLQ (Polymerase (DNA Directed), theta (POLQ))

Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLQ antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-POLQ Antibody

Binding Specificity: C-Term

Sequence: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL

Predicted Reactivity: Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 93%, Human: 100%, Mouse: 93%, Rabbit: 86%, Rat: 100%

Characteristics: This is a rabbit polyclonal antibody against POLQ. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (< a href="mailto:info@avivasysbio.com">info@avivasysbio.com).

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Target Details for POLQ

Target: POLQ (Polymerase (DNA Directed), theta (POLQ))

Alternative Name: POLQ

Background: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.

Alias Symbols: DKFZp781A0112, POLH, PRO0327

Protein Interaction Partner: AP2S1,

Protein Size: 1762

Gene ID: 10721

UniProt: O75417