ADAM2 antibody (N-Term)

Catalog No. ABIN5518722

Product Details anti-ADAM2 Antibody

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Binding Specificity: AA 231-274, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human,Mouse,Rat.

Sequence: WIDENKIATT GEANELLHTF LRWKTSYLVL RPHDVAFLLV YREK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ADAM metallopeptidase domain 2
Protein Name: Disintegrin and metalloproteinase domain-containing protein 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ADAM2

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Alternative Name: ADAM2 (ADAM2 Products)

Background: ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.

Synonyms: ADAM2 | CT15 | Fertilin beta | Fertilin subunit beta | Ftnb | PH30 | PH-30 | Ph30 beta | PH30-beta | Q99965

Gene ID: 2515

UniProt: Q99965