CYP2D6 antibody (C-Term)
-
- Target See all CYP2D6 Antibodies
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
-
Binding Specificity
- AA 315-347, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2D6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Cytochrome P450 2D6(CYP2D6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- AWGLLLMILH PDVQRRVQQE IDDVIGQVRR PEM
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Cytochrome P450 2D6(CYP2D6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cytochrome P450, family 2, subfamily D, polypeptide 6
Protein Name: Cytochrome P450 2D6 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).
- Isotype
- IgG
- Top Product
- Discover our top product CYP2D6 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
- Alternative Name
- CYP2D6 (CYP2D6 Products)
- Synonyms
- CPD6 antibody, CYP2D antibody, CYP2D7AP antibody, CYP2D7BP antibody, CYP2D7P2 antibody, CYP2D8P2 antibody, CYP2DL1 antibody, CYPIID6 antibody, P450-DB1 antibody, P450C2D antibody, P450DB1 antibody, CYP2D42 antibody, MGC64445 antibody, cyp2d2 antibody, cyp2d6-a antibody, CYP2D6 antibody, cytochrome P450 family 2 subfamily D member 6 antibody, cytochrome P450, family 2, subfamily D, polypeptide 6 antibody, cytochrome 2D6 antibody, cytochrome P450 family 2 subfamily D member 6 S homeolog antibody, cytochrome P450 2D6 antibody, cytochrome P450 2D6-like antibody, CYP2D6 antibody, cyp2d6-b antibody, cyp2d6.S antibody, cyp2d6 antibody, LOC100988273 antibody
- Background
-
Cytochrome P450 2D6 (CYP2D6) is one of the most important enzymes involved in the metabolism of xenobiotics in the body. It is a member of Cytochrome P450, family 2, subfamily D, polypeptide 6. This gene is mapped to chromosome 22q13.1. It has got 497 amino acid proteins which shares 73 % sequence identity with the rat protein. CYP2D6 is highly expressed in human liver and it is the major isozyme involved in the formation of N-hydroxyprocainamide, a metabolite potentially involved in the drug-induced lupus syndrome observed with procainamide.
Synonyms: Cytochrome P450 2D6 | 1.14.14.1 | CYPIID6 | Cytochrome P450-DB1 | Debrisoquine 4-hydroxylase | CYP2D6 | CYP2DL1 | P10635 - Gene ID
- 1565
- UniProt
- P10635
-