CYP2D6 antibody (N-Term)

Catalog No. ABIN630441

Product Details anti-CYP2D6 Antibody

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP2D6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CYP2 D6 antibody was raised against the N terminal of CYP2 6

Purification: Purified

Immunogen: CYP2 D6 antibody was raised using the N terminal of CYP2 6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP2D6 Blocking Peptide, catalog no. 33R-8102, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP2D6

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Alternative Name: CYP2D6 (CYP2D6 Products)

Background: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug, sparteine and propafenone, both anti-arrythmic drugs, and amitryptiline, an anti-depressant.

Molecular Weight: 55 kDa (MW of target protein)