Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6) (N-Term) antibody Primary Antibody
CYP2D6
Reactivity: Human, Mouse
IHC, WB
Host: Rabbit
Polyclonal
camera_alt 2
Catalog No. ABIN630441
$421.86
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 9 to 11 Business Days
-
- Target
- Binding Specificity
- N-Term
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- Un-conjugated
- Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificity
- CYP2 D6 antibody was raised against the N terminal of CYP2 6
- Purification
- Purified
- Immunogen
- CYP2 D6 antibody was raised using the N terminal of CYP2 6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
-
- Target
- Alternative Name
- CYP2D6 (CYP2D6 Antibody Abstract)
- Background
- CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug, sparteine and propafenone, both anti-arrythmic drugs, and amitryptiline, an anti-depressant.
- Molecular Weight
- 55 kDa (MW of target protein)
-
- Application Notes
- WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
CYP2D6 Blocking Peptide, catalog no. 33R-8102, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
You are here:
