DVL2 antibody (N-Term)

Catalog No. ABIN5518826

Product Details anti-DVL2 Antibody

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Binding Specificity: AA 35-64, N-Term

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DVL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-2(DVL2) detection. Tested with WB in Human,Mouse,Rat.

Sequence: AERITLGDFK SVLQRPAGAK YFFKSMDQDF

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-2(DVL2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dishevelled segment polarity protein 2
Protein Name: Segment polarity protein dishevelled homolog DVL-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Dishevelled 2 (35-64aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for DVL2

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Alternative Name: DVL2 (DVL2 Products)

Synonyms: Xdsh antibody, dishevelled antibody, dsh antibody, dvl antibody, Dvl-2 antibody, xdsh antibody, wu:fc05d12 antibody, wu:fo71e09 antibody, wu:fp54a02 antibody, zgc:55372 antibody, dishevelled segment polarity protein 2 antibody, dishevelled segment polarity protein 2 L homeolog antibody, DVL2 antibody, dvl2 antibody, Dvl2 antibody, dvl2.L antibody

Background: Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40 % amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

Synonyms: Dishevelled-2 | Dishevelled2 | DSH homolog 2 | DVL 2 | Dvl2 | O14641

Gene ID: 1856

UniProt: O14641

Pathways: Tube Formation