DVL2 antibody (N-Term)
-
- Target See all DVL2 Antibodies
- DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))
-
Binding Specificity
- AA 35-64, N-Term
-
Reactivity
- Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DVL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-2(DVL2) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- AERITLGDFK SVLQRPAGAK YFFKSMDQDF
- Cross-Reactivity (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Characteristics
-
Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-2(DVL2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dishevelled segment polarity protein 2
Protein Name: Segment polarity protein dishevelled homolog DVL-2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Dishevelled 2 (35-64aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product DVL2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))
- Alternative Name
- DVL2 (DVL2 Products)
- Synonyms
- Xdsh antibody, dishevelled antibody, dsh antibody, dvl antibody, Dvl-2 antibody, xdsh antibody, wu:fc05d12 antibody, wu:fo71e09 antibody, wu:fp54a02 antibody, zgc:55372 antibody, dishevelled segment polarity protein 2 antibody, dishevelled segment polarity protein 2 L homeolog antibody, DVL2 antibody, dvl2 antibody, Dvl2 antibody, dvl2.L antibody
- Background
-
Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40 % amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
Synonyms: Dishevelled-2 | Dishevelled2 | DSH homolog 2 | DVL 2 | Dvl2 | O14641 - Gene ID
- 1856
- UniProt
- O14641
- Pathways
- Tube Formation
-