TIMP3 antibody (Middle Region)

Catalog No. ABIN5518878

Product Details anti-TIMP3 Antibody

Target: TIMP3 (TIMP Metallopeptidase Inhibitor 3 (TIMP3))

Binding Specificity: AA 107-141, Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TIMP3 antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Purpose: Rabbit IgG polyclonal antibody for Metalloproteinase inhibitor 3(TIMP3) detection. Tested with WB, ELISA in Human,Mouse,Rat.

Sequence: RVYDGKMYTG LCNFVERWDQ LTLSQRKGLN YRYHL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Metalloproteinase inhibitor 3(TIMP3) detection. Tested with WB, ELISA in Human,Mouse,Rat.
Gene Name: TIMP metallopeptidase inhibitor 3
Protein Name: Metalloproteinase inhibitor 3

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-TIMP3 antibody (ABIN5518878)

Guan, Zhang, Song, Dai: "Promoter methylation and expression of TIMP3 gene in gastric cancer." in: Diagnostic pathology, Vol. 8, pp. 110, (2014) (PubMed).

Bai, Yi, Li, Sui: "Clinicopathologic significance of BAG1 and TIMP3 expression in colon carcinoma." in: World journal of gastroenterology, Vol. 13, Issue 28, pp. 3883-5, (2007) (PubMed).

Target Details for TIMP3

Target: TIMP3 (TIMP Metallopeptidase Inhibitor 3 (TIMP3))

Alternative Name: TIMP3 (TIMP3 Products)

Synonyms: TIMP-3 antibody, TIMP3 antibody, timp3 antibody, HSMRK222 antibody, K222 antibody, K222TA2 antibody, SFD antibody, IMP-3 antibody, timp3-A antibody, Timp-3 antibody, metalloproteinase inhibitor 3 antibody, TIMP metallopeptidase inhibitor 3 antibody, Metalloproteinase inhibitor 3 antibody, TIMP metallopeptidase inhibitor 3 L homeolog antibody, tissue inhibitor of metalloproteinase 3 antibody, CpipJ_CPIJ003282 antibody, TIMP3 antibody, timp3 antibody, Timp3 antibody, timp3.L antibody

Background: Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Synonyms: Metalloproteinase inhibitor 3 | Protein MIG-5 | Tissue inhibitor of metalloproteinases 3 | TIMP-3 | TIMP3 | P35625

Gene ID: 7078

UniProt: P35625