XPO5 antibody (N-Term)

Catalog No. ABIN5518968

Product Details anti-XPO5 Antibody

Target: XPO5 (Exportin 5 (XPO5))

Binding Specificity: AA 2-43, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XPO5 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Exportin-5(XPO5) detection. Tested with WB in Human,Mouse,Rat.

Sequence: AMDQVNALCE QLVKAVTVMM DPNSTQRYRL EALKFCEEFK EK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Exportin-5(XPO5) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: exportin 5
Protein Name: Exportin-5

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5 (2-43aa AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK), different from the related mouse sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for XPO5

Target: XPO5 (Exportin 5 (XPO5))

Alternative Name: XPO5 (XPO5 Products)

Synonyms: exp5 antibody, CG12234 antibody, Dmel\\CG12234 antibody, Exp-5 antibody, Exp5 antibody, RanBP21 antibody, dmExp5 antibody, 2410004H11Rik antibody, 2700038C24Rik antibody, AI648907 antibody, AW549301 antibody, RanBp21 antibody, mKIAA1291 antibody, exportin-5 antibody, ranbp21 antibody, DDBDRAFT_0185980 antibody, DDBDRAFT_0237583 antibody, DDB_0185980 antibody, DDB_0237583 antibody, XPO5 antibody, exportin 5 antibody, CG12234 gene product from transcript CG12234-RB antibody, armadillo-like helical domain-containing protein antibody, XPO5 antibody, Ranbp21 antibody, Xpo5 antibody, xpo5 antibody

Background: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.

Synonyms: Exportin-5, Exp5, Ran-binding protein 21, XPO5, KIAA1291, RANBP21

Gene ID: 57510

Pathways: Regulatory RNA Pathways, Protein targeting to Nucleus