Integrin alpha 3b antibody (Cytoplasmic Domain, N-Term)

Catalog No. ABIN5621198

This Mouse Monoclonal antibody specifically detects Integrin alpha 3b in IHC, WB and IHC (fro). It exhibits reactivity toward Human.

Quick Overview for Integrin alpha 3b antibody (Cytoplasmic Domain, N-Term) (ABIN5621198)

Target: Integrin alpha 3b

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Integrin alpha 3b antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: 54B3

Product Details anti-Integrin alpha 3b Antibody

Binding Specificity: Cytoplasmic Domain, N-Term

Specificity: Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart

Cross-Reactivity (Details): Human

Characteristics: Mouse monoclonal Integrin alpha 3B antibody

Immunogen: Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin as the immunogen.

Isotype: IgG1

Application Details

Application Notes: IHC: 1:25-1:200, WB: 1:100-1:1000

Restrictions: For Research Use only

Handling

Buffer: Supplied in PBS containing 0.09 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C

Target Details for Integrin alpha 3b

Target: Integrin alpha 3b