Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Kallikrein 10 antibody (KLK10) (AA 167-276) Primary Antibody

KLK10 Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN562461
$305.71
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Kallikrein 10 (KLK10)
    Binding Specificity
    AA 167-276
    Reactivity
    Human
    Host
    Mouse
    Clonality
    Polyclonal
    Conjugate
    This Kallikrein 10 antibody is un-conjugated
    Application
    ELISA, Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a partial recombinant KLK10.
    Cross-Reactivity
    Human, Mouse (Murine)
    Immunogen

    immunogen: KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Kallikrein 10 (KLK10)
    Alternative Name
    KLK10 (KLK10 Antibody Abstract)
    Synonyms
    KLK10, 2300002A13Rik, NES1, PRSSL1, kallikrein related peptidase 10, kallikrein related-peptidase 10, kallikrein-related peptidase 10, KLK10, Klk10
    Background
    Full Gene Name: kallikrein-related peptidase 10
    Synonyms: NES1,PRSSL1
    Gene ID
    5655
    NCBI Accession
    NP_002767, NM_002776
    Pathways
    Complement System
You are here: