Kallikrein 10 antibody (KLK10) (AA 167-276)

Catalog No. ABIN562461

Product Details anti-Kallikrein 10 Antibody

Target: Kallikrein 10 (KLK10)

See all Kallikrein 10 (KLK10) Antibodies

Binding Specificity: AA 167-276

Reactivity: Human

Host: Mouse

Clonality: Polyclonal

Conjugate: This Kallikrein 10 antibody is un-conjugated

Application: ELISA, Western Blotting (WB)

Purpose: Mouse polyclonal antibody raised against a partial recombinant KLK10.

Cross-Reactivity: Human, Mouse (Murine)

Immunogen:

immunogen: KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: 50 % glycerol

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details for Kallikrein 10

Target: Kallikrein 10 (KLK10)

See all Kallikrein 10 (KLK10) Antibodies

Alternative Name: KLK10 (KLK10 Antibody Abstract)

Synonyms: KLK10, 2300002A13Rik, NES1, PRSSL1, kallikrein related peptidase 10, kallikrein related-peptidase 10, kallikrein-related peptidase 10, KLK10, Klk10

Background: Full Gene Name: kallikrein-related peptidase 10
Synonyms: NES1,PRSSL1

Gene ID: 5655

NCBI Accession: NP_002767, NM_002776

Pathways: Complement System