Kallikrein 10 antibody (KLK10) (AA 167-276) Primary Antibody
KLK10
Reactivity: Human
ELISA, WB
Host: Mouse
Polyclonal
unconjugated
camera_alt 4
Catalog No. ABIN562461
$305.71
Plus shipping costs $45.00
50 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Kallikrein 10 (KLK10)
- Binding Specificity
- AA 167-276
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- This Kallikrein 10 antibody is un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a partial recombinant KLK10.
- Cross-Reactivity
- Human, Mouse (Murine)
- Immunogen
immunogen: KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag.
Immunogen Sequence: DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- 50 % glycerol
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Kallikrein 10 (KLK10)
- Alternative Name
- KLK10 (KLK10 Antibody Abstract)
- Synonyms
- KLK10, 2300002A13Rik, NES1, PRSSL1, kallikrein related peptidase 10, kallikrein related-peptidase 10, kallikrein-related peptidase 10, KLK10, Klk10
- Background
- Full Gene Name: kallikrein-related peptidase 10
Synonyms: NES1,PRSSL1 - Gene ID
- 5655
- NCBI Accession
- NP_002767, NM_002776
- Pathways
- Complement System
You are here: