USP4 antibody (Ubiquitin Specific Peptidase 4) (AA 676-773) Primary Antibody
USP4
Reactivity: Human
ELISA, WB
Host: Mouse
Monoclonal
5E12
camera_alt 2
Catalog No. ABIN563347
$440.00
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 676-773
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
- This USP4 antibody is un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a partial recombinant USP4.
- Cross-Reactivity
- Human
- Immunogen
immunogen: USP4 (NP_003354, 676 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK
- Clone
- 5E12
- Isotype
- IgG2a kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- USP4 (USP4 Antibody Abstract)
- Synonyms
- UNP, Unph, F730026I20Rik, Unp, mKIAA4155, ubiquitin specific peptidase 4, ubiquitin specific peptidase 4 (proto-oncogene), USP4, Usp4
- Background
- Full Gene Name: ubiquitin specific peptidase 4 (proto-oncogene)
Synonyms: MGC149848,MGC149849,UNP,Unph - Gene ID
- 7375
- NCBI Accession
- NP_003354, NM_003363
You are here: