MPP1 antibody (AA 409-450)

Catalog No. ABIN5646989

This anti-MPP1 antibody is a Rabbit Polyclonal antibody detecting MPP1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for MPP1 antibody (AA 409-450) (ABIN5646989)

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MPP1 Antibody

Binding Specificity: AA 409-450

Purification: Antigen affinity purified

Immunogen: Amino acids 409-450 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF) from the human protein were used as the immunogen for the MPP1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MPP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MPP1

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Alternative Name: MPP1

Background: Membrane Palmitoylated Protein 1, also called '55 kDa erythrocyte membrane protein,' is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q00013