Adenylate Kinase 1 antibody (AA 149-189)

Catalog No. ABIN5647008

This Rabbit Polyclonal antibody specifically detects Adenylate Kinase 1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Adenylate Kinase 1 antibody (AA 149-189) (ABIN5647008)

Target: Adenylate Kinase 1 (AK1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Adenylate Kinase 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Adenylate Kinase 1 Antibody

Binding Specificity: AA 149-189

Purification: Antigen affinity purified

Immunogen: Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the AK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Adenylate Kinase 1

Target: Adenylate Kinase 1 (AK1)

Alternative Name: AK1 / Adenylate Kinase 1

Background: This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

UniProt: P00568

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process