BDKRB2 antibody (AA 357-391)

Catalog No. ABIN5647061

This anti-BDKRB2 antibody is a Rabbit Polyclonal antibody detecting BDKRB2 in WB. Suitable for Human.

Quick Overview for BDKRB2 antibody (AA 357-391) (ABIN5647061)

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BDKRB2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BDKRB2 Antibody

Binding Specificity: AA 357-391

Purification: Antigen affinity purified

Immunogen: Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for BDKRB2

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Alternative Name: BDKRB2

Background: Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

UniProt: P30411

Pathways: ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling