IFNGR1 antibody (AA 108-147)

Catalog No. ABIN5647066

The Rabbit Polyclonal anti-IFNGR1 antibody has been validated for WB. It is suitable to detect IFNGR1 in samples from Human.

Quick Overview for IFNGR1 antibody (AA 108-147) (ABIN5647066)

Target: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFNGR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IFNGR1 Antibody

Binding Specificity: AA 108-147

Purification: Antigen affinity purified

Immunogen: Amino acids 108-147 (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) from the human protein were used as the immunogen for the CD119 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CD119 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CD119 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IFNGR1

Target: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Alternative Name: IFNGR1 / CD119

Background: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

UniProt: P15260

Pathways: Interferon-gamma Pathway