Superoxide dismutase copper chaperone antibody (AA 174-209)

Catalog No. ABIN5647094

This anti-Superoxide dismutase copper chaperone antibody is a Rabbit Polyclonal antibody detecting Superoxide dismutase copper chaperone in WB and IHC (p). Suitable for Human, Mouse and Rat.

Quick Overview for Superoxide dismutase copper chaperone antibody (AA 174-209) (ABIN5647094)

Target: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Superoxide dismutase copper chaperone antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-Superoxide dismutase copper chaperone Antibody

Binding Specificity: AA 174-209

Purification: Antigen affinity purified

Immunogen: Amino acids 174-209 (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) from the human protein were used as the immunogen for the CCS antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CCS antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CCS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Superoxide dismutase copper chaperone

Target: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Alternative Name: CCS / Copper chaperone for superoxide dismutase

Background: Copper chaperone for superoxide dismutase (CCS, SOD4) is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.

UniProt: O14618

Pathways: Transition Metal Ion Homeostasis