alpha Defensin 1 antibody (AA 65-94)

Catalog No. ABIN5647108

The Rabbit Polyclonal anti-alpha Defensin 1 antibody has been validated for WB. It is suitable to detect alpha Defensin 1 in samples from Human and Rat.

Quick Overview for alpha Defensin 1 antibody (AA 65-94) (ABIN5647108)

Target: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This alpha Defensin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-alpha Defensin 1 Antibody

Binding Specificity: AA 65-94

Purification: Antigen affinity purified

Immunogen: Amino acids 65-94 (ACYCRIPACIAGERRYGTCIYQGRLWAFCC) from the human protein were used as the immunogen for the Alpha Defensin 1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Alpha Defensin 1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Alpha Defensin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for alpha Defensin 1

Target: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Alternative Name: Alpha Defensin 1 / DEFA1

Background: Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.

UniProt: P59665

Pathways: Cellular Response to Molecule of Bacterial Origin